PDB entry 2bkz

View 2bkz on RCSB PDB site
Description: structure of cdk2-cyclin a with pha-404611
Class: transferase
Keywords: transferase/complex, protein kinase, transferase, serine/threonine-protein kinase, phosphorylation, cell division, cyclin, ATP-binding, cell cycle, mitosis, polymorphism
Deposited on 2005-02-23, released 2006-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKZ (172-177)
    • Uniprot P24941 (5-302)
    Domains in SCOPe 2.06: d2bkza2, d2bkza3
  • Chain 'B':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bkzb1, d2bkzb2
  • Chain 'C':
    Compound: Cell division protein kinase 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKZ (172-177)
    • Uniprot P24941 (5-End)
    Domains in SCOPe 2.06: d2bkzc2, d2bkzc3
  • Chain 'D':
    Compound: cyclin a2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bkzd1, d2bkzd2
  • Heterogens: SBC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkzA (A:)
    gplvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrlerphrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkzA (A:)
    plvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllk
    elnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgla
    fchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillg
    ckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdy
    kpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
    rl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkzB (B:)
    gplgsnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeykl
    qnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyt
    kkqvlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpy
    lkylpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqq
    sirekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkzB (B:)
    pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
    vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
    hlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsvi
    agaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekykn
    skyhgvsllnppetlnl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bkzC (C:)
    gplvdmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisll
    kelnhpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqgl
    afchshrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeill
    gckyystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpd
    ykpsfpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvph
    lrlerphrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkzC (C:)
    dmenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
    hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
    shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
    ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
    fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bkzD (D:)
    gplgsnevpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeykl
    qnetlhlavnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtyt
    kkqvlrmehlvlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpy
    lkylpsviagaafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqq
    sirekyknskyhgvsllnppetlnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkzD (D:)
    yhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavn
    yidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehl
    vlkvltfdlaaptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviag
    aafhlalytvtgqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknsk
    yhgvsllnppetlnl