PDB entry 2bky

View 2bky on RCSB PDB site
Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus
Class: DNA binding protein
Keywords: archaeal DNA binding protein, DNA condensation, DNA-binding, RNA-binding, DNA binding protein
Deposited on 2005-02-22, released 2005-07-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein alba 1
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bkya_
  • Chain 'B':
    Compound: DNA/RNA-binding protein alba 1
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bkyb_
  • Chain 'X':
    Compound: DNA/RNA-binding protein Alba 2
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bkyx_
  • Chain 'Y':
    Compound: DNA/RNA-binding protein Alba 2
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bkyy_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkyA (A:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkyA (A:)
    snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
    eirvgsqvvtsqdgrqsrvstieiairkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkyB (B:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    lpdkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkyB (B:)
    snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
    eirvgsqvvtsqdgrqsrvstieiairkk
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bkyX (X:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkyX (X:)
    klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
    vnvqtgsevrdrrrisyillrlkrvy
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2bkyY (Y:)
    mteklneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdg
    vqlvnvqtgsevrdrrrisyillrlkrvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkyY (Y:)
    klneivvrktknvedhvldvivlfnqgidevilkgtgreiskavdvynslkdrlgdgvql
    vnvqtgsevrdrrrisyillrlkrvy