PDB entry 2bkr

View 2bkr on RCSB PDB site
Description: nedd8 nedp1 complex
Class: protein-binding/hydrolase
Keywords: protein-binding-hydrolase complex, ubiquitin, hydrolase, protease, thiol protease, ubl conjugation pathway, ubiquitin-hydrolase complex
Deposited on 2005-02-18, released 2005-09-15
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.171
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96LD8 (0-211)
      • conflict (46)
      • conflict (100)
    Domains in SCOPe 2.04: d2bkra_
  • Chain 'B':
    Compound: Neddylin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKR (0-0)
    • Uniprot Q15843 (1-76)
    Domains in SCOPe 2.04: d2bkrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkrA (A:)
mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
qqtesllqlltpayitkkrgewkdliatlakk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2bkrB (B:)
smlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaady
kilggsvlhlvlalrgg