PDB entry 2bkq

View 2bkq on RCSB PDB site
Description: nedd8 protease
Class: hydrolase
Keywords: ubiquitin, hydrolase, protease, thiol protease, ubl conjugation pathway, ubiquitin-hydrolase complex
Deposited on 2005-02-18, released 2005-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bkqa1
  • Chain 'B':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bkqb_
  • Chain 'C':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bkqc_
  • Chain 'D':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bkqd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkqA (A:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdliatlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkqA (A:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaagshwsllvylqdknsffhydsh
    srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
    qtesllqlltpayitkkrgewkdliatlakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkqB (B:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdliatlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkqB (B:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrklafveekapaqqnsydcgmyvicntealcqnffrqqt
    esllqlltpayitkkrgewkdliatlakk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bkqC (C:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdliatlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkqC (C:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrlafveekapaqqnsydcgmyvicntealcqnffrqqte
    sllqlltpayitkkrgewkdliatlakk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bkqD (D:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdliatlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkqD (D:)
    dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtqf
    ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhydsh
    srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
    qtesllqlltpayitkkrgewkdliatlakk