PDB entry 2bkp

View 2bkp on RCSB PDB site
Description: structure analysis of unknown function protein
Class: hypothetical protein
Keywords: helix rich, hypothetical protein
Deposited on 2005-02-18, released 2006-06-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.225
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ph0236
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bkpa1, d2bkpa2
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkpA (A:)
    meeveefkyepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyq
    lmmhsvlaarnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilege
    eiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligr
    gtrtsidhlkeiargairvignera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkpA (A:)
    yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
    arnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilegeeiigkiqv
    ypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligrgtrtsidh
    lkeiargairvign