PDB entry 2bko

View 2bko on RCSB PDB site
Description: structure analysis of unknown function protein
Class: hypothetical protein
Keywords: helix rich, hypothetical protein
Deposited on 2005-02-17, released 2006-06-28
The last revision prior to the SCOP 1.75 freeze date was dated 2006-06-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ph0236
    Species: Pyrococcus horikoshii
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bkoa1, d2bkoa2
  • Heterogens: CA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkoA (A:)
    meeveefkyepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyq
    lmmhsvlaarnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilege
    eiigkiqvypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligr
    gtrtsidhlkeiargairvignera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkoA (A:)
    yepksvkeifiemkdtvelmvdlayasllfgdkeiaeevleleeridllnyqlmmhsvla
    arnvkeaeqvitilqianaiedisnaagdlakmvlegvelhpviketilegeeiigkiqv
    ypesvivgktlgeldlatntgvwiiavrrgkrwifgpnenfkiragdvligrgtrtsidh
    lkeiargairv