PDB entry 2bkl

View 2bkl on RCSB PDB site
Description: structural and mechanistic analysis of two prolyl endopeptidases: role of inter-domain dynamics in catalysis and specificity
Class: hydrolase
Keywords: prolyl endopeptidase, crystal structure, mechanistic study, celiac sprue, hydrolase, protease
Deposited on 2005-02-16, released 2005-03-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.161
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prolyl endopeptidase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bkla1, d2bkla2
  • Chain 'B':
    Compound: prolyl endopeptidase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bklb1, d2bklb2
  • Heterogens: ZAH, MES, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bklA (A:)
    msypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgreala
    arfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgt
    vslgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdsk
    gfyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgky
    lfvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfev
    dpakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlp
    gvgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnpeqyqveqv
    fyaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwldaggvyav
    anlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiyggsnggllvg
    aamtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlhayspyhhvr
    pdvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghggadqvaka
    iessvdlysflfqvldvqgaqggvaaqgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bklA (A:)
    sypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgrealaa
    rfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgtv
    slgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdskg
    fyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgkyl
    fvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfevd
    pakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlpg
    vgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnpeqyqveqvf
    yaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwldaggvyava
    nlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiyggsnggllvga
    amtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlhayspyhhvrp
    dvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghggadqvakai
    essvdlysflfqvldvq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bklB (B:)
    msypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgreala
    arfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgt
    vslgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdsk
    gfyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgky
    lfvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfev
    dpakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlp
    gvgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnpeqyqveqv
    fyaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwldaggvyav
    anlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiyggsnggllvg
    aamtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlhayspyhhvr
    pdvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghggadqvaka
    iessvdlysflfqvldvqgaqggvaaqgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bklB (B:)
    sypatraeqvvdtlhgvqvadpyrwledekapevqtwmtaqnaharealakfpgrealaa
    rfkelfytdsvstpsrrngrffyvrthkdkekailywrqgesgqekvlldpngwskdgtv
    slgtwavswdgkkvafaqkpnaadeavlhvidvdsgewskvdvieggkyatpkwtpdskg
    fyyewlptdpsikvderpgyttiryhtlgtepskdtvvhertgdpttflqsdlsrdgkyl
    fvyilrgwsendvywkrpgekdfrllvkgvgakyevhawkdrfyvltdegaprqrvfevd
    pakparaswkeivpedssasllsvsivgghlsleylkdatsevrvatlkgkpvrtvqlpg
    vgaasnlmgledlddayyvftsfttprqiyktsvstgkselwakvdvpmnpeqyqveqvf
    yaskdgtkvpmfvvhrkdlkrdgnaptllygyggfnvnmeanfrssilpwldaggvyava
    nlrgggeygkawhdagrldkkqnvfddfhaaaeylvqqkytqpkrlaiyggsnggllvga
    amtqrpelygavvcavplldmvryhlfgsgrtwipeygtaekpedfktlhayspyhhvrp
    dvrypallmmaadhddrvdpmharkfvaavqnspgnpatallrieanaghggadqvakai
    essvdlysflfqvldvqg