PDB entry 2bkc

View 2bkc on RCSB PDB site
Description: the x-ray structure of the h43g listeria innocua dps mutant
Class: iron oxidation and storage
Keywords: iron oxidation and storage, dps (DNA binding protein from starved cells), dps ferroxidase center, mutagenesis study, iron storage, metal transport, iron oxidation
Deposited on 2005-02-15, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkca1
  • Chain 'B':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcb_
  • Chain 'C':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcc_
  • Chain 'D':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcd_
  • Chain 'E':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkce_
  • Chain 'F':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcf_
  • Chain 'G':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcg_
  • Chain 'H':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkch_
  • Chain 'I':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkci_
  • Chain 'J':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcj_
  • Chain 'K':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkck_
  • Chain 'L':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcl_
  • Chain 'M':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcm_
  • Chain 'N':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcn_
  • Chain 'O':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkco_
  • Chain 'P':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcp_
  • Chain 'Q':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcq_
  • Chain 'R':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcr_
  • Chain 'S':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcs_
  • Chain 'T':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkct_
  • Chain 'U':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcu_
  • Chain 'V':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcv_
  • Chain 'X':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcx_
  • Chain 'Y':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (42)
    Domains in SCOPe 2.07: d2bkcy_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkcA (A:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcA (A:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bkcB (B:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcB (B:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bkcC (C:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcC (C:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bkcD (D:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcD (D:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bkcE (E:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcE (E:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bkcF (F:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcF (F:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bkcG (G:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcG (G:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bkcH (H:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcH (H:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bkcI (I:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcI (I:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2bkcJ (J:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcJ (J:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2bkcK (K:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcK (K:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2bkcL (L:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcL (L:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2bkcM (M:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcM (M:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2bkcN (N:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcN (N:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2bkcO (O:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcO (O:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2bkcP (P:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcP (P:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2bkcQ (Q:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcQ (Q:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2bkcR (R:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcR (R:)
    dtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerllai
    ggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegddv
    tndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2bkcS (S:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcS (S:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2bkcT (T:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcT (T:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2bkcU (U:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcU (U:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2bkcV (V:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcV (V:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bkcX (X:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcX (X:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2bkcY (Y:)
    mktinsvdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkcY (Y:)
    vdtkeflnhqvanlnvftvkihqihwymrghnfftlgekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple