PDB entry 2bka

View 2bka on RCSB PDB site
Description: cc3(tip30)crystal strucure
Class: transcription
Keywords: cc3, tip30, nadph, peg600, transcription
Deposited on 2005-02-14, released 2005-02-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-07-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.166
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tat-interacting protein tip30
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BUP3
      • conflict see remark 9 (181)
    Domains in SCOP 1.75: d2bkaa1
  • Heterogens: SO4, NDP, PE8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkaA (A:)
    maetealsklredfrmqnksvfilgasgetgrvllkeileqglfskvtligrrkltfdee
    ayknvnqevvdfeklddyasafqghdvgfcclgttrgkagaegfvrvdrdyvlksaelak
    aggckhfnllsskgadkssnflylqvkgeveakveelkfdrysvfrpgvllcdrqesrpg
    ewlvrkffgslpdswasghsvpvvtvvramlnnvvrprdkqmellenkaihdlgkahgsl
    kp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkaA (A:)
    ealsklredfrmqnksvfilgasgetgrvllkeileqglfskvtligrrkltfdeeaykn
    vnqevvdfeklddyasafqghdvgfcclgttrgkagaegfvrvdrdyvlksaelakaggc
    khfnllsskgadkssnflylqvkgeveakveelkfdrysvfrpgvllcdrqesrpgewlv
    rkffgslpdswasghsvpvvtvvramlnnvvrprdkqmellenkaihdlgka