PDB entry 2bka

View 2bka on RCSB PDB site
Description: CC3(TIP30)Crystal Structure
Class: transcription
Keywords: cc3, tip30, nadph, peg600, transcription
Deposited on 2005-02-14, released 2005-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tat-interacting protein tip30
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60520
      • conflict (181)
    Domains in SCOPe 2.07: d2bkaa1
  • Heterogens: NDP, PE8, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bkaA (A:)
    maetealsklredfrmqnksvfilgasgetgrvllkeileqglfskvtligrrkltfdee
    ayknvnqevvdfeklddyasafqghdvgfcclgttrgkagaegfvrvdrdyvlksaelak
    aggckhfnllsskgadkssnflylqvkgeveakveelkfdrysvfrpgvllcdrqesrpg
    ewlvrkffgslpdswasghsvpvvtvvramlnnvvrprdkqmellenkaihdlgkahgsl
    kp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bkaA (A:)
    ealsklredfrmqnksvfilgasgetgrvllkeileqglfskvtligrrkltfdeeaykn
    vnqevvdfeklddyasafqghdvgfcclgttrgkagaegfvrvdrdyvlksaelakaggc
    khfnllsskgadkssnflylqvkgeveakveelkfdrysvfrpgvllcdrqesrpgewlv
    rkffgslpdswasghsvpvvtvvramlnnvvrprdkqmellenkaihdlgka