PDB entry 2bk6

View 2bk6 on RCSB PDB site
Description: the x-ray crystal structure of the listeria innocua h31g dps mutant.
Class: iron oxidation and storage
Keywords: dps (DNA binding protein from starved cells), ferroxidase center, mutagenesis study, iron oxidation and storage, metal transport
Deposited on 2005-02-11, released 2005-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.212
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6a1
  • Chain 'B':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6b_
  • Chain 'C':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6c_
  • Chain 'D':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6d_
  • Chain 'E':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6e_
  • Chain 'F':
    Compound: non-heme iron-containing ferritin
    Species: Listeria innocua [TaxId:1642]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80725 (Start-155)
      • engineered mutation (30)
    Domains in SCOPe 2.07: d2bk6f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bk6A (A:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6A (A:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bk6B (B:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6B (B:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bk6C (C:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6C (C:)
    tinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevae
    rllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdk
    egddvtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bk6D (D:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6D (D:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bk6E (E:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6E (E:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bk6F (F:)
    mktinsvdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdev
    aerllaiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgielt
    dkegddvtndmliafkasidkhiwmfkaflgkaple
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bk6F (F:)
    vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
    iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
    vtndmliafkasidkhiwmfkaflgkaple