PDB entry 2bjx

View 2bjx on RCSB PDB site
Description:
Deposited on 1999-01-30, released 1999-02-09
The last revision prior to the SCOP 1.55 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.55: d2bjxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjxA (A:)
    aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk
    yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta