PDB entry 2bjx

View 2bjx on RCSB PDB site
Description: protein disulfide isomerase
Class: electron transport
Keywords: electron transport, redox-active center, isomerase, endoplasmic reticulum
Deposited on 1999-01-30, released 1999-02-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (protein disulfide isomerase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bjxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjxA (A:)
    aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk
    yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta