PDB entry 2bju

View 2bju on RCSB PDB site
Description: plasmepsin II complexed with a highly active achiral inhibitor
Class: hydrolase
Keywords: plasmepsin, aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen
Deposited on 2005-02-08, released 2005-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-05, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.19854
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasmepsin II
    Species: Plasmodium falciparum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bjua1
  • Heterogens: IH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjuA (A:)
    mditvrehdfkhgfiksnstfdglnidnsknkkkiqkgfqilyvllfcsvmcglfyyvye
    nvwlqrdnemneilknsehltigfkvenahdrilktikthklknyikesvnflnsgltkt
    nylgssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkh
    lydssksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptyt
    astfdgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieer
    fyegpltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldv
    ikvpflpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpv
    ptfilgdpfmrkyftvfdydnhsvgialakknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjuA (A:)
    ssndnielvdfqnimfygdaevgdnqqpftfildtgsanlwvpsvkcttagcltkhlyds
    sksrtyekdgtkvemnyvsgtvsgffskdlvtvgnlslpykfievidtngfeptytastf
    dgilglgwkdlsigsvdpivvelknqnkienalftfylpvhdkhtgfltiggieerfyeg
    pltyeklnhdlywqitldahvgnimlekancivdsgtsaitvptdflnkmlqnldvikvp
    flpfyvtlcnnsklptfeftsengkytlepeyylqhiedvgpglcmlniigldfpvptfi
    lgdpfmrkyftvfdydnhsvgialakknl