PDB entry 2bjr

View 2bjr on RCSB PDB site
Description: crystal structure of the nematode sperm cell motility protein mfp2b
Class: motility
Keywords: motility, ascaris, nematode, msp
Deposited on 2005-02-07, released 2005-03-16
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mfp2b
    Species: ASCARIS SUUM [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bjra1, d2bjra2
  • Chain 'B':
    Compound: mfp2b
    Species: ASCARIS SUUM [TaxId:6253]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2bjrb1, d2bjrb2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjrA (A:)
    mpnppakedtwafgpigspfpdnpvkalgqqnmyvalwykngrpmhgrawnnggviecsf
    pynkseltgvkdlggqiqvlqykgnhlslgywynwikysdrfdkmdkgaemlrcgdsfpi
    lwserpggallgyadnkteiarfshdgkvdevsgsalanmliiarelkggppyceceeck
    seppkpivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepv
    mgriwndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakew
    ipvhvdhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrk
    akpgctid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjrA (A:)
    akedtwafgpigspfpdnpvkalgqqnmyvalwykngrpmhgrawnnggviecsfpynks
    eltgvkdlggqiqvlqykgnhlslgywynwikysdrfdkmdkgaemlrcgdsfpilwser
    pggallgyadnkteiarfshdgkvdevsgsalanmliiarelkggppyceceeckseppk
    pivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgriw
    ndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakewipvhv
    dhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpgc
    tid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bjrB (B:)
    mpnppakedtwafgpigspfpdnpvkalgqqnmyvalwykngrpmhgrawnnggviecsf
    pynkseltgvkdlggqiqvlqykgnhlslgywynwikysdrfdkmdkgaemlrcgdsfpi
    lwserpggallgyadnkteiarfshdgkvdevsgsalanmliiarelkggppyceceeck
    seppkpivrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepv
    mgriwndggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqfgakew
    ipvhvdhhkgnispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrk
    akpgctid
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjrB (B:)
    akedtwafgpigspfpdnpvkalgqqnmyvalwykngrpmhgrawnnggviecsfpynks
    eltgvkdlggqiqvlqykgnhlslgywynwikysdrfdkmdkgaemlrcgdsfpilwser
    pggallgyadnkteiarfshdgkvdevsgsalanmliiarelkggppyceceeckseppk
    vrvtlnewadfrcgdpwptvgtpvralgrsldtlpgenpdqyvalwyqsgepvmgriwnd
    ggkiaacfgwggheyrqkigsiqilyelpeairgfdydwkpfpeaaqewipvhvdhhkgn
    ispavlivdgkeilgkadirneratigyggtekvlvgpavhscmvlcrkakpgctid