PDB entry 2bjq

View 2bjq on RCSB PDB site
Description: crystal structure of the nematode sperm cell motility protein mfp2
Class: motility
Keywords: motility, ascaris, nematode, msp
Deposited on 2005-02-07, released 2005-03-16
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-16, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.19121
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mfp2a
    Species: Ascaris suum
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7YXK2
      • conflict (222)
    Domains in SCOP 1.73: d2bjqa1, d2bjqa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bjqA (A:)
    mttkefedtwayntigspfpdnpvrvkgqqnmyvalwykfgkpihgrawndngnvecsfp
    ynkveltgardlggqiqiltateqdpteqfkktgfwyewrpykdrvndqllqlvrcgqst
    pvimktkdgkdllgyidmstevaavgvsgkseqvaggpiqdmlvlfrnvkappkgikiyd
    dtwldlkyrdpfpaarnpiaaggrkvksddgtemfqyvalwyehgqpvfgraypdsadkt
    lanfgwggqenagaeigsfqmlvvpdpdilgfeykwipykeakaggpfkplhvgectpcl
    lkdangterlgnlhmgmekataglagkdsavsgpavgdflvlcrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bjqA (A:)
    efedtwayntigspfpdnpvrvkgqqnmyvalwykfgkpihgrawndngnvecsfpynkv
    eltgardlggqiqiltateqdpteqfkktgfwyewrpykdrvndqllqlvrcgqstpvim
    ktkdgkdllgyidmstevaavgvsgkseqvaggpiqdmlvlfrnvkappkgikiyddtwl
    dlkyrdpfpaarnpiaaggrkvksddgtemfqyvalwyehgqpvfgraypdsadktlanf
    gwggqenagaeigsfqmlvvpdpdilgfeykwipykeakaggpfkplhvgectpcllkda
    ngterlgnlhmgmekataglagkdsavsgpavgdflvlcr