PDB entry 2bjm

View 2bjm on RCSB PDB site
Description: SPE7:Anthrone Complex
Class: immune system
Keywords: immune system, encounter complex
Deposited on 2005-02-04, released 2005-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-10-30, with a file datestamp of 2013-10-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.269
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: ige spe7 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BJM (0-119)
    Domains in SCOPe 2.07: d2bjmh_
  • Chain 'L':
    Compound: ige spe7 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BJM (0-109)
    Domains in SCOPe 2.07: d2bjml_
  • Heterogens: ANF

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjmH (H:)
    evqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpngggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarmwyygtyyfdywgqgttltvss
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjmL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgslignkaaltitgaqtedeaiyfcalwysnhlvfgggtkltvle