PDB entry 2bjj

View 2bjj on RCSB PDB site
Description: Structure of recombinant human lactoferrin produced in the milk of transgenic cows
Class: metal binding protein
Keywords: metal-binding protein, lactoferrin, transgenic cows, iron-binding, antibiotic, glycoprotein, polymorphism, metal binding protein
Deposited on 2005-02-03, released 2005-08-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: lactotransferrin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02788 (0-691)
      • conflict (28)
      • conflict (560)
    Domains in SCOPe 2.08: d2bjjx1, d2bjjx2
  • Heterogens: FE, CO3, NAG, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjjX (X:)
    grrrrsvqwcavsqpeatkcfqwqrnmrrvrgppvscikrdspiqciqaiaenradavtl
    dggfiyeaglapyklrpvaaevygterqprthyyavavvkkggsfqlnelqglkschtgl
    rrtagwnvpigtlrpflnwtgppepieaavarffsascvpgadkgqfpnlcrlcagtgen
    kcafssqepyfsysgafkclrdgagdvafirestvfedlsdeaerdeyellcpdntrkpv
    dkfkdchlarvpshavvarsvngkedaiwnllrqaqekfgkdkspkfqlfgspsgqkdll
    fkdsaigfsrvppridsglylgsgyftaiqnlrkseeevaarrarvvwcavgeqelrkcn
    qwsglsegsvtcssasttedcialvlkgeadamsldggyvytagkcglvpvlaenyksqq
    ssdpdpncvdrpvegylavavvrrsdtsltwnsvkgkkschtavdrtagwnipmgllfnq
    tgsckfdeyfsqscapgsdprsnlcalcigdeqgenkcvpnsneryygytgafrclaena
    gdvafvkdvtvlqntdgnnndawakdlkladfallcldgkrkpvtearschlamapnhav
    vsrmdkverlkqvllhqqakfgrngsdcpdkfclfqsetknllfndnteclarlhgktty
    ekylgpqyvagitnlkkcstsplleaceflrk