PDB entry 2bj9

View 2bj9 on RCSB PDB site
Description: nikr with bound nickel and phosphate
Class: transcription
Keywords: transcription, repressor, pyrococcus horikoshii, nikr, DNA-binding, metal-binding, nickel, transcription regulation, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2005-01-31, released 2005-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.186
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nickel responsive regulator
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bj9a1, d2bj9a2
  • Chain 'B':
    Compound: nickel responsive regulator
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bj9b1, d2bj9b2
  • Heterogens: NI, PO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bj9A (A:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtstgkelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bj9A (A:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtstg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bj9B (B:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtstgkelv