PDB entry 2bj1

View 2bj1 on RCSB PDB site
Description: nikr in open conformation and nickel bound to high-affinity sites
Class: transcription
Keywords: transcription, repressor, pyrococcus horikoshii, nikr, DNA-binding, metal-binding, nickel, transcription regulation, riken structural genomics/proteomics initiative, rsgi, structural genomics
Deposited on 2005-01-27, released 2005-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.237
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nickel responsive regulator
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bj1a1, d2bj1a2
  • Chain 'B':
    Compound: nickel responsive regulator
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bj1b1, d2bj1b2
  • Heterogens: NI, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bj1A (A:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtstgkelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bj1A (A:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bj1B (B:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtstgkelv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bj1B (B:)
    melirfsisipskllekfdqiieeigyenrseairdlirdfiirhewevgneevagtiti
    vynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakkikmiadkllsl
    kgvkhgklvmtst