PDB entry 2biy

View 2biy on RCSB PDB site
Description: structure of pdk1-s241a mutant kinase domain
Class: transferase
Keywords: agc kinase, ac-helix, ATP-binding, phosphorylation, phosphoinositide dependent protein kinase, pi3-kinase signalling, pif-pocket, pka, pkb, t-loop mutant, serine-threonine-protein kinase, transferase
Deposited on 2005-01-26, released 2005-02-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.186
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoinositide dependent protein kinase-1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15530
      • engineered mutation (190)
    Domains in SCOPe 2.05: d2biya_
  • Heterogens: GOL, SO4, ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2biyA (A:)
    mdgtaaeprpgagslqhaqpppqprkkrpedfkfgkilgegsfstvvlarelatsreyai
    kilekrhiikenkvpyvtrerdvmsrldhpffvklyftfqddeklyfglsyakngellky
    irkigsfdetctrfytaeivsaleylhgkgiihrdlkpenillnedmhiqitdfgtakvl
    speskqaranafvgtaqyvspellteksackssdlwalgciiyqlvaglppfragneyli
    fqkiikleydfpekffpkardlvekllvldatkrlgceemegygplkahpffesvtwenl
    hqqtppklta
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biyA (A:)
    pqprkkrpedfkfgkilgegsfstvvlarelatsreyaikilekrhiikenkvpyvtrer
    dvmsrldhpffvklyftfqddeklyfglsyakngellkyirkigsfdetctrfytaeivs
    aleylhgkgiihrdlkpenillnedmhiqitdfgtakvlspeskqaranafvgtaqyvsp
    ellteksackssdlwalgciiyqlvaglppfragneylifqkiikleydfpekffpkard
    lvekllvldatkrlgceemegygplkahpffesvtwenlhqqtppklt