PDB entry 2biw

View 2biw on RCSB PDB site
Description: crystal structure of apocarotenoid cleavage oxygenase from synechocystis, native enzyme
Class: oxidoreductase
Keywords: oxygenase, non-heme iron, carotenoid cleavage, retinal formation, oxidoreductase, dioxygenase
Deposited on 2005-01-26, released 2005-04-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.182
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apocarotenoid-cleaving oxygenase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2biwa_
  • Chain 'B':
    Compound: apocarotenoid-cleaving oxygenase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2biwb_
  • Chain 'C':
    Compound: apocarotenoid-cleaving oxygenase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2biwc_
  • Chain 'D':
    Compound: apocarotenoid-cleaving oxygenase
    Species: Synechocystis sp. [TaxId:1148]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2biwd_
  • Heterogens: 3ON, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2biwA (A:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biwA (A:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2biwB (B:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biwB (B:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2biwC (C:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biwC (C:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2biwD (D:)
    mvtspptsspsqrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpgllei
    gdrplkhpfdgdgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpagg
    wlktifdlrlkniantnitywgdrllalweggqphrlepsnlatiglddlggilaegqpl
    sahpridpastfdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdf
    aitphyaiflqnnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqag
    fvfhhanafeengkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatve
    kqlmvsrccefpvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfap
    hgfagepifvprpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhip
    yplhgswaqt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biwD (D:)
    qrsyspqdwlrgyqsqpqewdywvedvegsippdlqgtlyrngpglleigdrplkhpfdg
    dgmvtafkfpgdgrvhfqskfvrtqgyveeqkagkmiyrgvfgsqpaggwlktifdlrlk
    niantnitywgdrllalweggqphrlepsnlatiglddlggilaegqplsahpridpast
    fdggqpcyvtfsiksslsstltlleldpqgkllrqktetfpgfafihdfaitphyaiflq
    nnvtlnglpylfglrgagecvqfhpdkpaqiilvprdggeikripvqagfvfhhanafee
    ngkiildsicynslpqvdtdgdfrstnfdnldpgqlwrftidpaaatvekqlmvsrccef
    pvvhpqqvgrpyryvymgaahhstgnaplqailkvdlesgtetlrsfaphgfagepifvp
    rpggvaeddgwllcliykadlhrselvildaqditapaiatlklkhhipyplhgswaqt