PDB entry 2biv

View 2biv on RCSB PDB site
Description: Crystal structure of the wild-type MBT domains of Human SCML2
Class: transcription
Keywords: malignant brain tumor, transcription factor, transcription
Deposited on 2005-01-26, released 2005-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.7000000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex comb on midleg-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2biva1, d2biva2
  • Chain 'B':
    Compound: sex comb on midleg-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bivb1, d2bivb2
  • Chain 'C':
    Compound: sex comb on midleg-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bivc1, d2bivc2
  • Heterogens: IOD, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bivA (A:)
    mgqtvnedsmdvkkenqektpqsstssvqrddfhweeylketgsisapsecfrqsqippv
    ndfkvgmkleardprnatsvciatvigitgarlrlrldgsdnrndfwrlvdspdiqpvgt
    cekegdllqpplgyqmntsswpmfllktlngsemasatlfkkeppkpplnnfkvgmklea
    idkknpylicpatigdvkgdevhitfdgwsgafdywckydsrdifpagwcrltgdvlqpp
    gts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bivA (A:)
    dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
    rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmntsswpmfllktlng
    semasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdevhitfdgwsg
    afdywckydsrdifpagwcrltgdvlqppgts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bivB (B:)
    mgqtvnedsmdvkkenqektpqsstssvqrddfhweeylketgsisapsecfrqsqippv
    ndfkvgmkleardprnatsvciatvigitgarlrlrldgsdnrndfwrlvdspdiqpvgt
    cekegdllqpplgyqmntsswpmfllktlngsemasatlfkkeppkpplnnfkvgmklea
    idkknpylicpatigdvkgdevhitfdgwsgafdywckydsrdifpagwcrltgdvlqpp
    gts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bivB (B:)
    svqrddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvi
    gitgarlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgswpmfllktlngs
    emasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdevhitfdgwsga
    fdywckydsrdifpagwcrltgdvlqppgts
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bivC (C:)
    mgqtvnedsmdvkkenqektpqsstssvqrddfhweeylketgsisapsecfrqsqippv
    ndfkvgmkleardprnatsvciatvigitgarlrlrldgsdnrndfwrlvdspdiqpvgt
    cekegdllqpplgyqmntsswpmfllktlngsemasatlfkkeppkpplnnfkvgmklea
    idkknpylicpatigdvkgdevhitfdgwsgafdywckydsrdifpagwcrltgdvlqpp
    gts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bivC (C:)
    dfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitga
    rlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgemasatlfkkeppkppln
    nfkvgmkleaidkknpylicpatigdvkgdevhitfdgwsgafdywckydsrdifpagwc
    rltgdvlqppgts