PDB entry 2bit

View 2bit on RCSB PDB site
Description: Crystal structure of human cyclophilin D at 1.7 A resolution
Class: isomerase
Keywords: crystal engineering, cis-tran-isomerization, human, mitochondrial protein, isomerase
Deposited on 2005-01-26, released 2005-01-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.7100000000000002 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30405 (Start-164)
      • engineered mutation (132)
    Domains in SCOPe 2.08: d2bitx1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bitX (X:)
    sgnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsf
    mcqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktd
    wldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bitX (X:)
    gnplvyldvdangkplgrvvlelkadvvpktaenfralctgekgfgykgstfhrvipsfm
    cqagdftnhngtggksiygsrfpdenftlkhvgpgvlsmanagpntngsqffictiktdw
    ldgkhvvfghviegmdvvkkiesfgsksgrtskkivitdcgqls