PDB entry 2biq

View 2biq on RCSB PDB site
Description: human p53 core domain mutant t123a-m133l-h168r-v203a-n239y-r249s-n268d
Class: DNA-binding protein
Keywords: 3d-structure, activator, anti-oncogene, apoptosis, disease mutation, DNA-binding, DNA-binding protein, li-fraumeni syndrome, nuclear protein, p53 DNA-binding domain, phosphorylation, polymorphism, second-site suppressor mutation, superstable mutant, transcription regulation, tumor suppressor, transferase, acetylation, glycoprotein metal-binding, zinc
Deposited on 2005-01-25, released 2005-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.214
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular tumor antigen p53
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04637
      • engineered mutation (29)
      • engineered mutation (39)
      • engineered mutation (74)
      • engineered mutation (109)
      • engineered mutation (145)
      • engineered mutation (155)
      • engineered mutation (174)
    Domains in SCOPe 2.07: d2biqa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2biqA (A:)
    sssvpsqktyqgsygfrlgflhsgtaksvactyspalnklfcqlaktcpvqlwvdstppp
    gtrvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlraeylddrntfr
    hsvvvpyeppevgsdcttihynymcysscmggmnrspiltiitledssgnllgrdsfevr
    vcacpgrdrrteeenlrkkgephhelppgstkralpnnt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2biqA (A:)
    svpsqktyqgsygfrlgflsvactyspalnklfcqlaktcpvqlwvdstpppgtrvrama
    iykqsqrmtevvrrcphhercsdglappqhlirvegnlraeylddrntfrhsvvvpyepp
    evgsdcttihynymcysscgmnrspiltiitledssgnllgrdsfevrvcacpgrdrrte
    eenlr