PDB entry 2bif

View 2bif on RCSB PDB site
Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase h256a mutant with f6p in phosphatase active site
Class: transferase, hydrolase
Keywords: kinase, transferase (phospho), phosphatase, hydrolase (phospho), glycolysis, bifunctional enzyme, transferase, hydrolase
Deposited on 1998-10-26, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RT2K
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25114 (Start-468)
      • engineered (64)
      • engineered (256)
      • engineered (299)
      • engineered (320)
    Domains in SCOPe 2.08: d2bifa1, d2bifa2
  • Chain 'B':
    Compound: protein (6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase)
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RT2K
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25114 (Start-468)
      • engineered (64)
      • engineered (256)
      • engineered (299)
      • engineered (320)
    Domains in SCOPe 2.08: d2bifb1, d2bifb2
  • Heterogens: BOG, F6P, MG, PO4, ANP, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bifA (A:)
    maspreltqnplkkifmpysngrpalhasqrgvcmtncptlivmvglpargktyiskklt
    rylnfigvptrefnvgqyrrdmvktyksfefflpdneeglkirkqcalaalndvrkflse
    egghvavfdatnttrerramifnfgeqngyktffvesicvdpeviaanivqvklgspdyv
    nrdsdeatedfmrriecyensyesldeeqdrdlsyikimdvgqsyvvnrvadhiqsrivy
    ylmnihvtprsiylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvf
    tsqmkrtiqtaealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryry
    pkgesyedlvqrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtv
    lkltpvaygckvesiflnvaavnthrdrpqnvdisrpseealvtvpahq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bifA (A:)
    cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
    eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
    icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
    imdvgqsyvvnrvadhiqsrivyylmnihvtprsiylcrageselnlkgriggdpglspr
    grefskhlaqfisdqnikdlkvftsqmkrtiqtaealsvpyeqfkvlneidagvceemty
    eeiqdhyplefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldkaaeelpylkcplhtvlkltpvaygckvesiflnvaavnthrdrpqnvdisrp
    seealvtvpahq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bifB (B:)
    maspreltqnplkkifmpysngrpalhasqrgvcmtncptlivmvglpargktyiskklt
    rylnfigvptrefnvgqyrrdmvktyksfefflpdneeglkirkqcalaalndvrkflse
    egghvavfdatnttrerramifnfgeqngyktffvesicvdpeviaanivqvklgspdyv
    nrdsdeatedfmrriecyensyesldeeqdrdlsyikimdvgqsyvvnrvadhiqsrivy
    ylmnihvtprsiylcrageselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvf
    tsqmkrtiqtaealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryry
    pkgesyedlvqrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtv
    lkltpvaygckvesiflnvaavnthrdrpqnvdisrpseealvtvpahq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bifB (B:)
    cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
    eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
    icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
    imdvgqsyvvnrvadhiqsrivyylmnihvtprsiylcrageselnlkgriggdpglspr
    grefskhlaqfisdqnikdlkvftsqmkrtiqtaealsvpyeqfkvlneidagvceemty
    eeiqdhyplefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldkaaeelpylkcplhtvlkltpvaygckvesiflnvaavnthrdrpqnvdisrp
    seealvtvpahq