PDB entry 2bid

View 2bid on RCSB PDB site
Description: human pro-apoptotic protein bid
Class: apoptosis
Keywords: programmed cell death, apoptosis regulation and amplification
Deposited on 1999-01-27, released 2000-01-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (bid)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55957 (2-196)
      • insertion (0-1)
    Domains in SCOPe 2.05: d2bida_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bidA (A:)
    gsmdcevnngsslrdecitnllvfgflqscsdnsfrreldalghelpvlapqwegydelq
    tdgnrsshsrlgrieadsesqediirniarhlaqvgdsmdrsippglvnglalqlrntsr
    seedrnrdlataleqllqayprdmekektmlvlalllakkvashtpsllrdvfhttvnfi
    nqnlrtyvrslarngmd