PDB entry 2bi6

View 2bi6 on RCSB PDB site
Description: nmr study of bromelain inhibitor vi from pineapple stem
Class: cysteine protease inhibitor
Keywords: cysteine protease inhibitor
Deposited on 1995-12-07, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: bromelain inhibitor vi
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bi6.2, d2bi6h1
  • Chain 'L':
    Compound: bromelain inhibitor vi
    Species: Ananas comosus [TaxId:4615]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bi6.2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bi6H (H:)
    eeykcyctdtysdcpgfcktckaefgkyicldlispndcvk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bi6L (L:)
    tacsecvcplr