PDB entry 2bi5

View 2bi5 on RCSB PDB site
Description: Radiation damage of the Schiff base in phosphoserine aminotransferase (structure E)
Class: transferase
Keywords: transferase, aminotransferase, pyridoxal-5'-phosphate, radiation damage
Deposited on 2005-01-20, released 2005-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-22, with a file datestamp of 2019-05-17.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoserine aminotransferase
    Species: BACILLUS ALCALOPHILUS [TaxId:1445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bi5a_
  • Chain 'B':
    Compound: phosphoserine aminotransferase
    Species: BACILLUS ALCALOPHILUS [TaxId:1445]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bi5b_
  • Heterogens: PLP, MG, CL, 1PE, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bi5A (A:)
    vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
    lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
    stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
    plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
    tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
    fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bi5B (B:)
    vkqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrel
    lqipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaa
    stkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsr
    plkvnqfgmiyagaqknlgpsgvtvvivkkdllntkveqvptmlqyathiksdslyntpp
    tfsiymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvt
    fnlrneelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bi5B (B:)
    kqvfnfnagpsalpkpaleraqkellnfndtqmsvmelshrsqsyeevheqaqnllrell
    qipndyqilflqggaslqftmlpmnlltkgtignyvltgswsekalkeakllgethiaas
    tkansyqsipdfsefqlnendaylhitsnntiygtqyqnfpeinhapliadmssdilsrp
    lkvnqfgmiyagaqknlgpsgvtvvivkkdllveqvptmlqyathiksdslyntpptfsi
    ymlrnvldwikdlggaeaiakqneekakiiydtidesngfyvghaekgsrslmnvtfnlr
    neelnqqflakakeqgfvglnghrsvggcrasiynavpidacialrelmiqfkena