PDB entry 2bi0

View 2bi0 on RCSB PDB site
Description: rv0216, a conserved hypothetical protein from mycobacterium tuberculosis that is essential for bacterial survival during infection, has a double hotdogfold
Class: hypothetical protein
Keywords: hypothetical protein, conserved hypothetical, rv0216, mycobacterium tuberculosis, hotdog-fold, structural proteomics in europe, spine, structural genomics
Deposited on 2005-01-20, released 2005-04-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.175
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein rv0216
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2bi0a1, d2bi0a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bi0A (A:)
    vasgyggirvggpyfddlskgqvfdwapgvtlslglaaahqsivgnrlrlaldsdlcaav
    tgmpgplahpglvcdvaigqstlatqrvkanlfyrglrfhrfpavgdtlytrtevvglra
    nspkpgraptglaglrmttidrtdrlvldfyrcamlpaspdwkpgavpgddlsrigadap
    apaadptahwdgavfrkrvpgphfdagiagavlhstadlvsgapelarltlniaathhdw
    rvsgrrlvygghtiglalaqatrllpnlatvldwescdhtapvhegdtlyselhiesaqa
    hadggvlglrslvyavsdsasepdrqvldwrfsalqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bi0A (A:)
    irvggpyfddlskgqvfdwapgvtlslglaaahqsivgnrlrlaldsdlcaavtgmpgpl
    ahpglvcdvaigqstlatqrvkanlfyrglrfhrfpavgdtlytrtevvglranspkpgr
    aptglaglrmttidrtdrlvldfyrcamlpaspdwkpgavpgddlsrigadapapaadpt
    ahwdgavfrkrvpgphfdagiagavlhstadlvsgapelarltlniaathhdwrvsgrrl
    vygghtiglalaqatrllpnlatvldwescdhtapvhegdtlyselhiesaqahadggvl
    glrslvyavsdsasepdrqvldwrfsalqf