PDB entry 2bhz

View 2bhz on RCSB PDB site
Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with maltose
Class: hydrolase
Keywords: hydrolase, d. radiodurans, trehalose, alpha-amylase, protein- carbohydrate complex, desiccation resistance glycosidase
Deposited on 2005-01-20, released 2005-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.125
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltooligosyltrehalose trehalohydrolase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX51 (432-601)
    • PDB 2BHZ (430-431)
    Domains in SCOPe 2.07: d2bhza1, d2bhza2, d2bhza3
  • Heterogens: MAL, BME, TRS, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhzA (A:)
    mtqtqpvtptppasfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmt
    slgggiyelelpvgpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwh
    gikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydga
    afyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssa
    wgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelg
    gthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealayti
    rrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlh
    eyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkkefggfsgfsg
    edvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnrqrenlttghd
    gdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegredltlgageavl
    vg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhzA (A:)
    sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
    gpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwhgikladcvfyevh
    vgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydgaafyapyapygrpe
    dlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssawgmgldyaephmr
    ryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelggthlllaedhrnl
    pdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealaytirrgwryegqfwav
    kgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlheyrgaaallltlp
    mtpllfqgqewaastpfqffsdhagelgqavsegrkkefggfsgfsgedvpdpqaeqtfl
    nsklnwaereggehartlrlyrdllrlrredpvlhnrqrenlttghdgdvlwvrtvtgag
    ervllwnlgqdtravaevklpftvprrlllhtegredltlgageavlvg