PDB entry 2bhy

View 2bhy on RCSB PDB site
Description: Crystal structure of Deinococcus radiodurans maltooligosyltrehalose trehalohydrolase in complex with trehalose
Class: hydrolase
Keywords: hydrolase, d. radiodurans, trehalose, alpha-amylase, protein- carbohydrate complex, desiccation resistance, glycosidase
Deposited on 2005-01-20, released 2005-03-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltooligosyltrehalose trehalohydrolase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX51 (432-601)
    • PDB 2BHY (430-431)
    Domains in SCOPe 2.08: d2bhya1, d2bhya2, d2bhya3
  • Heterogens: TRS, BME, GLC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhyA (A:)
    mtqtqpvtptppasfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmt
    slgggiyelelpvgpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwh
    gikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydga
    afyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssa
    wgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelg
    gthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealayti
    rrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlh
    eyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkkefggfsgfsg
    edvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnrqrenlttghd
    gdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegredltlgageavl
    vg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhyA (A:)
    sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
    gpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwhgikladcvfyevh
    vgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydgaafyapyapygrpe
    dlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssawgmgldyaephmr
    ryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelggthlllaedhrnl
    pdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealaytirrgwryegqfwav
    kgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlheyrgaaallltlp
    mtpllfqgqewaastpfqffsdhagelgqavsegrkkefdvpdpqaeqtflnsklnwaer
    eggehartlrlyrdllrlrredpvlhnrqrenlttghdgdvlwvrtvtgagervllwnlg
    qdtravaevklpftvprrlllhtegredltlgageavlvg