PDB entry 2bhu

View 2bhu on RCSB PDB site
Description: crystal structure of deinococcus radiodurans maltooligosyltrehalose trehalohydrolase
Class: hydrolase
Keywords: trehalose, alpha-amylase, hydrolase, protein-carbohydrate complex, desiccation resistance
Deposited on 2005-01-18, released 2005-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.129
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltooligosyltrehalose trehalohydrolase
    Species: DEINOCOCCUS RADIODURANS [TaxId:243230]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RX51 (432-601)
    • PDB 2BHU (430-431)
    Domains in SCOPe 2.07: d2bhua1, d2bhua2, d2bhua3
  • Heterogens: TRS, PGE, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhuA (A:)
    mtqtqpvtptppasfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmt
    slgggiyelelpvgpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwh
    gikladcvfyevhvgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydga
    afyapyapygrpedlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssa
    wgmgldyaephmrryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelg
    gthlllaedhrnlpdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealayti
    rrgwryegqfwavkgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlh
    eyrgaaallltlpmtpllfqgqewaastpfqffsdhagelgqavsegrkkefggfsgfsg
    edvpdpqaeqtflnsklnwaereggehartlrlyrdllrlrredpvlhnrqrenlttghd
    gdvlwvrtvtgagervllwnlgqdtravaevklpftvprrlllhtegredltlgageavl
    vg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhuA (A:)
    sfqtqhdprtrlgatplpggagtrfrlwtstartvavrvngtehvmtslgggiyelelpv
    gpgarylfvldgvptpdpyarflpdgvhgeaevvdfgtfdwtdadwhgikladcvfyevh
    vgtftpegtyraaaeklpylkelgvtaiqvmplaafdgqrgwgydgaafyapyapygrpe
    dlmalvdaahrlglgvfldvvynhfgpsgnylssyapsyftdrfssawgmgldyaephmr
    ryvtgnarmwlrdyhfdglrldatpymtddsethiltelaqeihelggthlllaedhrnl
    pdlvtvnhldgiwtddfhhetrvtltgeqegyyagyrggaealaytirrgwryegqfwav
    kgeeherghpsdaleapnfvyciqnhdqignrplgerlhqsdgvtlheyrgaaallltlp
    mtpllfqgqewaastpfqffsdhagelgqavsegrkkefdvpdpqaeqtflnsklnwaer
    eggehartlrlyrdllrlrredpvlhnrqrenlttghdgdvlwvrtvtgagervllwnlg
    qdtravaevklpftvprrlllhtegredltlgageavlvg