PDB entry 2bhk
View 2bhk on RCSB PDB site
Description: crystal structure of human growth and differentiation factor 5 (gdf5)
Class: growth factor
Keywords: growth factor, growth differentiation factor, bone morphogenetic factor, hormone-receptor interaction, cystine knot, preformed receptor dimer, cytokine, dwarfism, glycoprotein
Deposited on
2005-01-12, released
2005-03-11
The last revision prior to the SCOPe 2.02 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.36
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: growth differentiation factor 5
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.02: d2bhka_ - Heterogens: IPA, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2bhkA (A:)
aplatrqgkrpsknlkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshl
eptnhaviqtlmnsmdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr
Sequence, based on observed residues (ATOM records): (download)
>2bhkA (A:)
karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsm
dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr