PDB entry 2bhk

View 2bhk on RCSB PDB site
Description: crystal structure of human growth and differentiation factor 5 (gdf5)
Class: growth factor
Keywords: growth factor, growth differentiation factor, bone morphogenetic factor, hormone-receptor interaction, cystine knot, preformed receptor dimer, cytokine, dwarfism, glycoprotein
Deposited on 2005-01-12, released 2005-03-11
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: growth differentiation factor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2bhka_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhkA (A:)
    aplatrqgkrpsknlkarcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshl
    eptnhaviqtlmnsmdpestpptccvptrlspisilfidsannvvykqyedmvvescgcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhkA (A:)
    karcsrkalhvnfkdmgwddwiiapleyeafhceglcefplrshleptnhaviqtlmnsm
    dpestpptccvptrlspisilfidsannvvykqyedmvvescgcr