PDB entry 2bhi

View 2bhi on RCSB PDB site
Description: crystal structure of taiwan cobra cardiotoxin a3 complexed with sulfogalactoceramide
Class: cardiotoxin
Keywords: cardiotoxin, cobra cardiotoxin, sulfogalactoceramide sulfatide, glycosphingolipid, membrane pore formation, cytolysis
Deposited on 2005-01-12, released 2005-11-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytotoxin 3
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bhia_
  • Chain 'B':
    Compound: cytotoxin 3
    Species: Naja atra [TaxId:8656]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bhib_
  • Heterogens: SFT, C10, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bhiA (A:)
    lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bhiB (B:)
    lkcnklvplfyktcpagknlcykmfmvatpkvpvkrgcidvcpkssllvkyvccntdrcn