PDB entry 2bhf

View 2bhf on RCSB PDB site
Description: 3d structure of the reduced form of cota
Class: oxidoreductase
Keywords: oxidoreductase, multicopper-oxidase, laccase, oxygen reduction
Deposited on 2005-01-10, released 2005-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.175
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bhfa1, d2bhfa2, d2bhfa3
  • Heterogens: CU1, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bhfA (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bhfA (A:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtiheepevktvvhlhggvtpddsdgypeawfskdf
    eqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsd
    eydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevep
    rkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidft
    ayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypsvqheriq
    nirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvs
    frvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgr
    yvwhchilehedydmmrpmditdp