PDB entry 2bhc

View 2bhc on RCSB PDB site
Description: na substituted e. coli aminopeptidase p
Class: hydrolase
Keywords: proline-specific peptidase, metalloenzyme, pita-bread fold, dinuclear hydrolase
Deposited on 2005-01-10, released 2005-09-29
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.17712
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2bhca1, d2bhca2
  • Heterogens: NA, FLC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bhcA (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq