PDB entry 2bh7

View 2bh7 on RCSB PDB site
Description: crystal structure of a semet derivative of amid at 2.2 angstroms
Class: hydrolase
Keywords: zinc amidase, pgrp, T7 lysozyme, ampd, hydrolase
Deposited on 2005-01-07, released 2006-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-03-09, with a file datestamp of 2010-03-05.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.231
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylmuramoyl-l-alanine amidase
    Species: ESCHERICHIA COLI [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bh7a1, d2bh7a2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bh7A (A:)
    mgagekgivekegyqldtrrqaqaayprikvlvihytaddfdsslatltdkqvsshylvp
    avppryngkpriwqlvpeqelawhagisawrgatrlndtsigielenrgwqksagvkyfa
    pfepaqiqaliplakdiiaryhikpenvvahadiapqrkddpgplfpwqqlaqqgigawp
    daqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptlyn
    geadaetqaiaeallekygqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bh7A (A:)
    givekegyqldtrrqaqaayprikvlvihytaddfdsslatltdkqvsshylvpavppry
    ngkpriwqlvpeqelawhagisawrgatrlndtsigielenrgwqksagvkyfapfepaq
    iqaliplakdiiaryhikpenvvahadiapqrkddpgplfpwqqlaqqgigawpdaqrvn
    fylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptlyngeadae
    tqaiaeallekygq