PDB entry 2bh4

View 2bh4 on RCSB PDB site
Description: x-ray structure of the m100k variant of ferric cyt c-550 from paracoccus versutus determined at 100 k.
Class: electron transfer
Keywords: c-type cytochrome, heme, electron transfer, axial ligand, pyrrolidone carboxylic acid
Deposited on 2005-01-07, released 2005-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.15
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: cytochrome c-550
    Species: PARACOCCUS VERSUTUS [TaxId:34007]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00499
      • engineered mutation (99)
    Domains in SCOPe 2.07: d2bh4x_
  • Heterogens: HEC, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2bh4X (X:)
    qegdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgil
    evaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkktfklgknqadvvaflaqhsp
    dagaeaapaegaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bh4X (X:)
    egdaakgekefnkckachmvqapdgtdivkggktgpnlygvvgrkiasvegfkygdgile
    vaeknpdmvwseadlieyvtdpkpwlvektgdsaaktkktfklgknqadvvaflaqhspd
    ag