PDB entry 2bh3

View 2bh3 on RCSB PDB site
Description: zn substituted e.coli aminopeptidase p in complex with product
Class: hydrolase
Keywords: hydrolase, proline-specific peptidase, product complex, metalloenzyme, pita-bread fold, dinuclear hydrolase
Deposited on 2005-01-07, released 2005-09-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.175
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xaa-pro aminopeptidase
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bh3a1, d2bh3a2
  • Heterogens: PRO, LEU, ZN, MG, FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bh3A (A:)
    seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
    vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
    lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfkspee
    iavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsgengc
    ilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivleslets
    lrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwlgldv
    hdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgnenlt
    asvvkkpeeiealmvaarkq