PDB entry 2bgl

View 2bgl on RCSB PDB site
Description: x-ray structure of binary-secoisolariciresinol dehydrogenase
Class: xidoreductase
Keywords: xidoreductase, oxidoreductase, dehydrogenase
Deposited on 2004-12-23, released 2005-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.201
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhizome secoisolariciresinol dehydrogenase
    Species: PODOPHYLLUM PELTATUM [TaxId:35933]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bgla_
  • Heterogens: NAJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bglA (A:)
    mgststpdsstnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnni
    gspdvisfvhcdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkr
    vmdinvygaflvakhaarvmipakkgsivftasissftagegvshvytatkhavlgltts
    lctelgeygirvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadav
    aylagdeskyvsglnlvidggytrtnpafptalkhgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bglA (A:)
    tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh
    cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf
    lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi
    rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky
    vsglnlvidggytrtnpafptalkhgl