PDB entry 2bgk

View 2bgk on RCSB PDB site
Description: x-ray structure of apo-secoisolariciresinol dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, dehydrogenase
Deposited on 2004-12-23, released 2005-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhizome secoisolariciresinol dehydrogenase
    Species: PODOPHYLLUM PELTATUM [TaxId:35933]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bgka1
  • Chain 'B':
    Compound: rhizome secoisolariciresinol dehydrogenase
    Species: PODOPHYLLUM PELTATUM [TaxId:35933]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bgkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bgkA (A:)
    mgststpdsstnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnni
    gspdvisfvhcdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkr
    vmdinvygaflvakhaarvmipakkgsivftasissftagegvshvytatkhavlgltts
    lctelgeygirvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadav
    aylagdeskyvsglnlvidggytrtnpafptalkhgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgkA (A:)
    tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh
    cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf
    lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi
    rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky
    vsglnlvidggytrtnpafptalkhgla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bgkB (B:)
    mgststpdsstnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnni
    gspdvisfvhcdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkr
    vmdinvygaflvakhaarvmipakkgsivftasissftagegvshvytatkhavlgltts
    lctelgeygirvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadav
    aylagdeskyvsglnlvidggytrtnpafptalkhgla
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgkB (B:)
    tnrlqdkvaiitggaggigettaklfvrygakvviadiaddhgqkvcnnigspdvisfvh
    cdvtkdedvrnlvdttiakhgkldimfgnvgvlsttpysileagnedfkrvmdinvygaf
    lvakhaarvmipakkgsivftasissftagegvshvytatkhavlglttslctelgeygi
    rvncvspyivasplltdvfgvdssrveelahqaanlkgtllraedvadavaylagdesky
    vsglnlvidggytrtnpafptalkhgla