PDB entry 2bgc

View 2bgc on RCSB PDB site
Description: prfa-g145s, a constitutive active mutant of the transcriptional regulator in l.monocytogenes
Class: transcription
Keywords: bacterial infection, human pathogen, transcriptional regulator, transcription
Deposited on 2004-12-20, released 2005-04-14
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262 (Start-237)
    Domains in SCOPe 2.04: d2bgca1, d2bgca2
  • Chain 'B':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC (Start-1)
      • engineered mutation (145)
    • Uniprot P22262 (2-237)
    Domains in SCOPe 2.04: d2bgcb1, d2bgcb2
  • Chain 'D':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262 (Start-237)
    Domains in SCOPe 2.04: d2bgcd1, d2bgcd2
  • Chain 'E':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC (Start-1)
      • engineered mutation (145)
    • Uniprot P22262 (2-237)
    Domains in SCOPe 2.04: d2bgce1, d2bgce2
  • Chain 'F':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262 (2-237)
    Domains in SCOPe 2.04: d2bgcf1, d2bgcf2
  • Chain 'G':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262 (Start-237)
    Domains in SCOPe 2.04: d2bgcg1, d2bgcg2
  • Chain 'H':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262
    Domains in SCOPe 2.04: d2bgch1, d2bgch2
  • Chain 'I':
    Compound: prfa
    Species: LISTERIA MONOCYTOGENES [TaxId:169963]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BGC
      • engineered mutation (145)
    • Uniprot P22262 (2-237)
    Domains in SCOPe 2.04: d2bgci1, d2bgci2
  • Heterogens: DTU, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bgcA (A:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcA (A:)
    aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy
    ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk
    qvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgiah
    ssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bgcB (B:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcB (B:)
    snaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bgcD (D:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcD (D:)
    aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy
    ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk
    qvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgsavsrii
    sklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bgcE (E:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcE (E:)
    snaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnl
    qyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtl
    qkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgi
    ahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bgcF (F:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcF (F:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bgcG (G:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcG (G:)
    aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy
    ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk
    qvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgiah
    ssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bgcH (H:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcH (H:)
    aqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlqy
    ykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlqk
    qvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelsavsriis
    klkqekvivyknscfyvqnldylkryapkldewfylacpatwgk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bgcI (I:)
    gsnaqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimn
    lqyykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqt
    lqkqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssg
    iahssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bgcI (I:)
    naqaeefkkyletngikpkqfhkkelifnqwdpqeyciflydgitkltsisengtimnlq
    yykgafvimsgfidtetsvgyynleviseqatayvikinelkellsknlthffyvfqtlq
    kqvsyslakfndfsingklgsicsqlliltyvygketpdgikitldnltmqelgyssgia
    hssavsriisklkqekvivyknscfyvqnldylkryapkldewfylacpatwgkln