PDB entry 2bfy

View 2bfy on RCSB PDB site
Description: complex of Aurora-B with INCENP and Hesperidin.
Class: transferase
Keywords: transferase, kinase, mitosis, inhibition, transferase complex
Deposited on 2004-12-15, released 2005-05-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-20, with a file datestamp of 2015-05-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DE08
      • engineered (18)
    Domains in SCOPe 2.06: d2bfya_
  • Chain 'B':
    Compound: aurora kinase b-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6DE08 (0-End)
      • engineered (18)
    Domains in SCOPe 2.06: d2bfyb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: H1N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bfyA (A:)
    talaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfyA (A:)
    rkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiq
    shlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalh
    ycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkt
    hdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllr
    yhppqrlplkgvmehpwvkansrrvlppvyqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bfyB (B:)
    talaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfyB (B:)
    talaempkrkftiddfdivrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
    lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
    eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
    pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
    dliskllryhppqrlplkgvmehpwvkansrrvlppvyqs
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.