PDB entry 2bfu

View 2bfu on RCSB PDB site
Description: X-ray structure of CPMV top component
Class: virus
Keywords: comovirus, virus, viral coat protein, cowpea mosaic virus cpmv, top component, nanotechnology, empty particles, icosahedral virus
Deposited on 2004-12-13, released 2005-01-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 4 Å
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: cowpea mosaic virus, large (l) subunit
    Species: COWPEA MOSAIC VIRUS [TaxId:12264]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bful1, d2bful2
  • Chain 'S':
    Compound: cowpea mosaic virus, small (s) subunit
    Species: COWPEA MOSAIC VIRUS [TaxId:12264]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2bfus1

PDB Chain Sequences:

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bfuL (L:)
    meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
    aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
    knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
    iyhladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwr
    yfrgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfs
    qqefvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsn
    pgidgsrll
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bfuS (S:)
    gpvcaeasdvyspcmiastppapfsdvtavtfdlingkitpvgddnwnthiynppimnvl
    rtaawksgtihvqlnvrgagvkradwdgqvfvylrqsmnpesydartfvisqpgsamlnf
    sfdiigpnsgfefaespwanqttwylecvatnprqiqqfevnmrfdpnfrvagnilmppf
    plstetppl