PDB entry 2bfp

View 2bfp on RCSB PDB site
Description: leishmania major pteridine reductase 1 in complex with nadp and tetrahydrobiopterin
Class: oxidoreductase
Keywords: pteridine reductase, trypanosomatids, drug resistance, pterin salvage, short-chain dehydrogenase/reductase, methotrexate resistance, nadp, oxidoreductase
Deposited on 2004-12-10, released 2005-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfpa1
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfpb1
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfpc1
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfpd1
  • Heterogens: NAP, H4B, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bfpA (A:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfpA (A:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrngdreametata
    dlfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgal
    egltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvv
    iflcsskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bfpB (B:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfpB (B:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllgdreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvi
    flcsskakyitgtcvkvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bfpC (C:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfpC (C:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskakyi
    tgtcvkvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bfpD (D:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfpD (D:)
    tvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqa
    dlsnvatapvapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlvghrskvplyqrdssaaevsdvviflcsskaky
    itgtcvkvdggysltra