PDB entry 2bfh

View 2bfh on RCSB PDB site
Description: crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
Class: growth factor
Keywords: growth factor
Deposited on 1993-08-31, released 1994-01-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.169
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: basic fibroblast growth factor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bfha_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bfhA (A:)
    dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamke
    dgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
    flpmsaks