PDB entry 2bfh

View 2bfh on RCSB PDB site
Description: crystal structure of basic fibroblast growth factor at 1.6 angstroms resolution
Deposited on 1993-08-31, released 1994-01-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-04-30, with a file datestamp of 1994-05-17.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.169
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d2bfh__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2bfh_ (-)
  dpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvcanrylamke
  dgrllaskcvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpgqkail
  flpmsaks