PDB entry 2bfe

View 2bfe on RCSB PDB site
Description: Reactivity modulation of human branched-chain alpha-ketoacid dehydrogenase by an internal molecular switch
Class: oxidoreductase
Keywords: oxidoreductase, oxidative decarboxylation, maple syrup urine disease, thiamine diphosphate, phosphorylation, conformational switch
Deposited on 2004-12-06, released 2006-02-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.15
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxoisovalerate dehydrogenase alpha subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bfea1
  • Chain 'B':
    Compound: 2-oxoisovalerate dehydrogenase beta subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2bfeb1, d2bfeb2
  • Heterogens: K, MN, CL, TDP, GOL, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bfeA (A:)
    sslddkpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlkl
    yksmtllntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgaareagvlm
    yrdyplelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakr
    ananrvvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgia
    argpgygimsirvdgndvfavynatkearrravaenqpflieamtyrighhstsddssaf
    rsvdevnywdkqdhpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnp
    nllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfeA (A:)
    kpqfpgasaefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmt
    llntmdrilyesqrqgrisfymtnygeegthvgsaaaldntdlvfgaareagvlmyrdyp
    lelfmaqcygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananr
    vvicyfgegaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpg
    ygimsirvdgndvfavynatkearrravaenqpflieamtyrighstdhpisrlrhylls
    qgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempaqlrkqqeslarh
    lqtygehypldhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bfeB (B:)
    vahftfqpdpepreygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvgl
    rdkygkdrvfntplceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryr
    sgdlfncgsltirspwgcvghgalyhsqspeaffahcpgikvviprspfqakglllscie
    dknpciffepkilyraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasm
    akeklgvscevidlrtiipwdvdticksviktgrllisheapltggfaseisstvqeecf
    lnleapisrvcgydtpfphifepfyipdkwkcydalrkminy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfeB (B:)
    eygqtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntp
    lceqgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltir
    spwgcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkil
    yraaaeevpiepyniplsqaeviqegsdvtlvawgtqvhvirevasmakeklgvscevid
    lrtiipwdvdticksviktgrllisheapltggfaseisstvqeecflnleapisrvcgy
    dtpfphifepfyipdkwkcydalrkminy