PDB entry 2bfa

View 2bfa on RCSB PDB site
Description: leishmania major pteridine reductase 1 in complex with nadp and cb3717
Class: oxidoreductase
Keywords: pteridine reductase, trypanosomatids, drug resistance, pterin salvage, short-chain dehydrogenase/reductase, methotrexate resistance, nadp, oxidoreductase
Deposited on 2004-12-06, released 2005-08-31
The last revision prior to the SCOP 1.75 freeze date was dated 2005-08-31, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.205
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfaa1
  • Chain 'B':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfab1
  • Chain 'C':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfac1
  • Chain 'D':
    Compound: pteridine reductase 1
    Species: Leishmania major
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2bfad1
  • Heterogens: NDP, CB3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bfaA (A:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfaA (A:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrdreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvif
    lcsskakyitgtcvkvdggysltra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bfaB (B:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfaB (B:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrgdreametatad
    lfgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgale
    gltrsaalelaplqirvngvgpglsvlvddmppavweghrskvplyqrdssaaevsdvvi
    flcsskakyitgtcvkvdggysltra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2bfaC (C:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfaC (C:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrreametatadlf
    gsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgalegl
    trsaalelaplqirvngvgpglsvlvrskvplyqrdssaaevsdvviflcsskakyitgt
    cvkvdggysltra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bfaD (D:)
    mtaptvpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsai
    tvqadlsnvatapvsgadgsapvtlftrcaelvaacythwgrcdvlvnnassfyptpllr
    ndedghepcvgdreametatadlfgsnaiapyflikafahrvagtpakhrgtnysiinmv
    damtnqpllgytiytmakgalegltrsaalelaplqirvngvgpglsvlvddmppavweg
    hrskvplyqrdssaaevsdvviflcsskakyitgtcvkvdggysltra
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bfaD (D:)
    vpvalvtgaakrlgrsiaeglhaegyavclhyhrsaaeanalsatlnarrpnsaitvqad
    lsnvatapapvtlftrcaelvaacythwgrcdvlvnnassfyptpllrdreametatadl
    fgsnaiapyflikafahrvagtpakhrgtnysiinmvdamtnqpllgytiytmakgaleg
    ltrsaalelaplqirvngvgpglsvlvhrskvplyqrdssaaevsdvviflcsskakyit
    gtcvkvdggysltra